Vials
10 mg vials. Neutral label by default; your own label, carton and insert from 100 kits (1,000 vials).
SeqLine Bio · Catalog · VIP (Vasoactive Intestinal Peptide)
28-residue neuropeptide · research use only
VIP: bulk and private-label supply.
Vasoactive intestinal peptide, the C-terminally amidated 28-residue sequence (CAS 40077-57-4), supplied lyophilized in 10 mg vials. Made to order.
VIPHPLC per lot COAMS per lot COA10mg
Photo of the standard vial. Each lot carries its own lot number on the label and on its COA.
| Compound | VIP (Vasoactive Intestinal Peptide) |
|---|---|
| CAS number | 40077-57-4 |
| Molecular formula | C147H238N44O42S |
| Molecular weight | 3325.8 g/mol |
| Sequence | HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 |
| Form | Lyophilized powder, glass vial |
| HPLC purity | Specification NLT 98.0%; result on each lot COA |
| Vial formats | 10mg |
| Documentation | Lot COA with HPLC purity and MS identity |
| Distribution scope | B2B research-use supply to supported destinations; product and import requirements confirmed before payment. View shipping coverage → |
| Storage | Keep the lyophilized powder at −20 °C, dry and away from light; −80 °C for longer storage. Once reconstituted, refrigerate at 2–8 °C and use promptly. As with all peptides, avoid repeated freeze-thaw cycles. Ships with COA. |
MOQ & lead time
| Order type | Minimum order | Dispatch window |
|---|---|---|
| Made-to-order production | 100 kits (1,000 vials) | 7–15 business days after specification and payment confirmation. |
| Private-label OEM | 100 kits (1,000 vials) | 7–15 business days after specification, payment and artwork approval. |
This product is made to order; a 1-kit sample is not offered under the published procurement policy. Specification, lot or production plan and dispatch date are confirmed before payment. Kit price steps do not change the minimum. Transit and customs are additional.
Research use only, B2B supply. Made to order; RFQ reply within 4 business hours.
Need to verify the supplier before ordering? Supplier Verification & Buyer Due Diligence →
What it is
What is VIP?
Vasoactive intestinal peptide (VIP) is a 28-amino-acid neuropeptide of the secretin/glucagon peptide family: HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2, with a C-terminal amide. CAS 40077-57-4, formula C147H238N44O42S, molecular weight 3325.8 g/mol. Supplied as lyophilized powder; store at −20 °C protected from light and moisture (−80 °C for long-term storage) and avoid repeated freeze-thaw cycles.
What you get
Vials, batch documents and lead times.
Batch documents
A COA for the lot you receive, with HPLC purity against our NLT 98.0% release specification and MS molecular-weight identity. Published lots are in the COA library; independent testing is welcome.
Order size and timing
Made to order, from the minimum in the table above. Production lots ship 7–15 business days after specification and payment are confirmed.
FAQ
Questions buyers ask about VIP.
Can I order other fill weights or bulk powder?
Yes. Other fill weights and raw VIP powder are quoted on request. Include the target amount and specification in your RFQ.
Which documents can I get beyond the COA?
The lot COA reports RP-HPLC purity and MS identity against the expected mass of the amidated 28-mer. Net peptide and counter-ion content, and endotoxin if ordered, can be provided on request.
Can I see the COA before I pay?
Yes. The quotation includes the COA for the lot you would receive, and published lots are listed in the public COA library. A confirmed quality issue is replaced or refunded under our quality policy.
Related
Related compounds.
COA library search
Search public COAs for this product.
No batch record for this product is published yet. Ask for the COA of the lot you would receive when you send your RFQ, or search the library in case a record has been added since.