Vials
2 mg vials; custom fills on request. Neutral label by default; your own label, carton and insert from 100 kits (1,000 vials).
SeqLine Bio · Catalog · LL-37
37-residue cathelicidin peptide · research use only
LL-37: bulk and private-label supply.
The 37-amino-acid human cathelicidin peptide, supplied as lyophilized powder. Made to order, with HPLC purity and MS identity on each lot COA.
Lot LL37-2
HPLC per lot COA
MS per lot COA
2 mg
Photo of the standard vial. Each lot carries its own lot number on the label and on its COA.
| Compound | LL-37 (Cathelicidin antimicrobial peptide) |
|---|---|
| Sequence | [LL-37, 37 aa] |
| Molecular weight | ≈ 4493 g/mol |
| Form | Lyophilized powder, glass vial |
| HPLC purity | Specification NLT 98.0%; result on each lot COA |
| Vial formats | 2 mg (custom on request) |
| Documentation | Lot COA with HPLC purity and MS identity |
| Storage | 2–8 °C protected from light; long-term −20 °C |
MOQ & lead time
| Order type | Minimum order | Dispatch window |
|---|---|---|
| Made-to-order production | 100 kits (1,000 vials) | 7–15 business days after specification and payment confirmation. |
| Private-label OEM | 100 kits (1,000 vials) | 7–15 business days after specification, payment and artwork approval. |
This product is made to order; a 1-kit sample is not offered under the published procurement policy. Specification, lot or production plan and dispatch date are confirmed before payment. Kit price steps do not change the minimum. Transit and customs are additional.
Research use only, B2B supply. Made to order; RFQ reply within 4 business hours.
Need to verify the supplier before ordering? Supplier Verification & Buyer Due Diligence →
What it is
What is LL-37?
LL-37 is a 37-amino-acid peptide and the only cathelicidin found in humans. Its sequence starts with two leucines (LL) and runs [LL-37, 37 aa]; the molecular weight is about 4493 g/mol. We supply it as lyophilized powder in glass vials. Keep sealed vials at 2–8 °C away from light; use −20 °C for longer storage.
What you get
Vials, batch documents and lead times.
Batch documents
A COA for the lot you receive, with HPLC purity against our NLT 98.0% release specification and MS molecular-weight identity. Published lots are in the COA library; independent testing is welcome.
Order size and timing
Made to order, from the minimum in the table above. Production lots ship 7–15 business days after specification and payment are confirmed.
FAQ
Questions buyers ask about LL-37.
Can I order other fill weights or bulk powder?
Yes. Other fill weights and raw LL-37 powder are quoted on request. Include the target amount and specification in your RFQ.
Can I see the COA before I pay?
Yes. The quotation includes the COA for the lot you would receive, and published lots are listed in the public COA library. A confirmed quality issue is replaced or refunded under our quality policy.
Related
Related compounds.
COA library search
Search public COAs for this product.
No batch record for this product is published yet. Ask for the COA of the lot you would receive when you send your RFQ, or search the library in case a record has been added since.